PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr031306.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 300aa    MW: 33768.8 Da    PI: 6.8835
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr031306.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.6e-131259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd+ l  ++ + G g+W+t++   g+ R +k+c++rw +yl
      Pbr031306.1 12 KGLWSPEEDLMLRSYILKNGHGCWSTVPINTGLQRNGKSCRLRWINYL 59
                     678*******************************************97 PP

2Myb_DNA-binding49.31.2e-1565110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++++e ++ +++++G++ W+ Ia++++ gRt++++k++w+++l
      Pbr031306.1  65 RGTFSKQDEETILTLHRMFGNK-WSQIAQHLP-GRTDNEIKNYWHSHL 110
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.162759IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-20762IPR009057Homeodomain-like
SuperFamilySSF466893.12E-2710106IPR009057Homeodomain-like
SMARTSM007174.2E-91161IPR001005SANT/Myb domain
PfamPF002491.9E-111259IPR001005SANT/Myb domain
CDDcd001674.32E-81559No hitNo description
PROSITE profilePS5129425.57260114IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2563114IPR009057Homeodomain-like
SMARTSM007177.2E-1664112IPR001005SANT/Myb domain
PfamPF002491.3E-1465110IPR001005SANT/Myb domain
CDDcd001672.10E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGSDKPKAKY RKGLWSPEED LMLRSYILKN GHGCWSTVPI NTGLQRNGKS CRLRWINYLR  60
PGLKRGTFSK QDEETILTLH RMFGNKWSQI AQHLPGRTDN EIKNYWHSHL KKKVDKAEEM  120
EGQTKSQYTS TSSSEILECS LSPQKPTTCF NSSHESVQKS PPLVSQLDDL SKDQSCQRSP  180
LPKILFAEWL SLDQVDGGSF ANNISDPGVL KEEFDHSTTS NNLQADHALG HGFVLNDEGI  240
FGSGFHHGIS HHHGLGLEMI NSQFKFEEQI SGPGFVDFVP GGDLYSDFNL QNDAMYFYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-22121157109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340007.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K45e-62LAF1_ARATH; Transcription factor LAF1
TrEMBLM5XTG91e-154M5XTG9_PRUPE; Uncharacterized protein
STRINGGLYMA16G31280.13e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.18e-63myb domain protein 18